{"product_id":"proteintech-10105-2-ap","title":"Proteintech, 10105-2-AP, UBE2T\/HSPC150 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBE2T\/HSPC150 (10105-2-AP) by Proteintech is a Polyclonal antibody targeting UBE2T\/HSPC150 in WB, IF\/ICC, IP, ELISA applications with reactivity to human samples\n10105-2-AP targets UBE2T\/HSPC150 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HepG2 cells,  K-562 cells,  Jurkat cells,  SKOV-3 cells\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe ubiquitin (Ub)-mediated protein degradation pathway involves three sequential enzymatic steps that facilitate the conjugation of Ub to specific protein substrates. The first step requires ATP-dependent activation of the C-terminus of Ub and the assembly of multi-Ubs by Ub-activating enzyme E1. The ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain, is then conjugated to Ubs, through a thiol-ester linkage between a conserved cysteine and the C-terminus of Ub, to generate an intermediate Ub-E2 complex. Then the E3, a ligase, catalyzes the transfer of Ub from E2 to the appropriate substrate. This pathway regulates many fundamental cellular processes.  There are also other E2s which form thiol-ester linkages without the use of E3s as well as several UBC homologs (TSG101, Mms2, Croc-1 and similar proteins), which lack the active site cysteine essential for ubiquitination and appear to function in DNA repair pathways.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0153 Product name: Recombinant human UBE2T protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-190 aa of BC004152 Sequence: QRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIE Predict reactive species\nFull Name: ubiquitin-conjugating enzyme E2T (putative)\nCalculated Molecular Weight: 23 kDa\nObserved Molecular Weight: 23 kDa\nGenBank Accession Number: BC004152\nGene Symbol: UBE2T\nGene ID (NCBI): 29089\nRRID: AB_2211478\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NPD8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868870693033,"sku":"10105-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10105-2-ap","provider":"Iright","version":"1.0","type":"link"}