{"product_id":"proteintech-10113-2-ap","title":"Proteintech, 10113-2-AP, LDOC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LDOC1 (10113-2-AP) by Proteintech is a Polyclonal antibody targeting LDOC1 in WB, ELISA applications with reactivity to human,  mouse samples\n10113-2-AP targets LDOC1 in WB, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, SKOV-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLDOC1 contains a leucine zipper-like motif and a proline-rich region that shares marked similarity with an SH3-binding domain. LDOC1 localizes to the nucleus and is down-regulated in some cancer cell lines. LDOC1 regulates the transcriptional response mediated by the nuclear factor B (NF-kappa B). The gene encoding LDOC1 protein has been proposed as a tumor suppressor gene which may have an important role in the development and\/or progression of some cancers.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0158 Product name: Recombinant human LDOC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-146 aa of BC003104 Sequence: MVDELVLLLHALLMRHRALSIENSQLMEQLRLLVCERASLLRQVRPPSCPVPFPETFNGESSRLPEFIVQTASYMLVNENRFCNDAMKVAFLISLLTGEAEEWVVPYIEMDSPILGDYRAFLDEMKQCFGWDDDEDDDDEEEEDDY Predict reactive species\nFull Name: leucine zipper, down-regulated in cancer 1\nCalculated Molecular Weight: 17 kDa\nObserved Molecular Weight: 17 kDa, 25 kDa\nGenBank Accession Number: BC003104\nGene Symbol: LDOC1\nGene ID (NCBI): 23641\nRRID: AB_2135421\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95751\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869702443177,"sku":"10113-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10113-2-ap","provider":"Iright","version":"1.0","type":"link"}