{"product_id":"proteintech-10129-2-ap","title":"Proteintech, 10129-2-AP, NFYC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NFYC (10129-2-AP) by Proteintech is a Polyclonal antibody targeting NFYC in WB, ELISA applications with reactivity to human samples\n10129-2-AP targets NFYC in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNFYC, also named as Nuclear transcription factor Y subunit gamma or Transactivator HSM-1\/2, is a 458 amino acid protein, which belongs to the NFYC\/HAP5 subunit family. NFYC localizes in the nucleus and stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters, for example in type 1 collagen, albumin and beta-actin genes. SP1, NFYC and FOXO3, FOXO4 transcription factors are involved in the regulation of STK11 transcription.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0140 Product name: Recombinant human NFYC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-251 aa of BC005003 Sequence: MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYI Predict reactive species\nFull Name: nuclear transcription factor Y, gamma\nCalculated Molecular Weight: 37 kDa, 50 kDa\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC005003\nGene Symbol: NFYC\nGene ID (NCBI): 4802\nRRID: AB_2152244\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13952\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869718696105,"sku":"10129-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10129-2-ap","provider":"Iright","version":"1.0","type":"link"}