{"product_id":"proteintech-10136-1-ap","title":"Proteintech, 10136-1-AP, MNK1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MNK1 (10136-1-AP) by Proteintech is a Polyclonal antibody targeting MNK1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10136-1-AP targets MNK1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  HEK-293 cells,  HepG2 cells,  HL-60 cells,  mouse small intestine tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMNK1 (mitogen-activated protein kinase-interacting kinase 1) was discovered as a consequence of bacterial expression libraries screening for proteins regulated by the classical mitogen-activated protein kinases, the ERKs (extracellular signal-regulated kinases). Phosphorylation of Mnk1 has been shown to activate its kinase activity as well as to enhance its binding to the eukaryotic initiation factor 4G (eIF4G) which functions as a scaffolding protein. Human MNK1 arises from an alternatively spliced transcript giving rise to 2 isoforms, longer MNK1a (50 kDa) and a shorter MNK1b variant (38 kDa) that lacks 89 C-terminal amino acids(PMID: 21406405).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0184 Product name: Recombinant human MKNK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 299-465 aa of BC002755 Sequence: PPFVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDLISKLLVRDAKQRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENELAEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL Predict reactive species\nFull Name: MAP kinase interacting serine\/threonine kinase 1\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 51 kDa, 47 kDa\nGenBank Accession Number: BC002755\nGene Symbol: MNK1\nGene ID (NCBI): 8569\nRRID: AB_2250527\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BUB5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869473263785,"sku":"10136-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10136-1-ap","provider":"Iright","version":"1.0","type":"link"}