{"product_id":"proteintech-10145-1-ap","title":"Proteintech, 10145-1-AP, TMOD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMOD1 (10145-1-AP) by Proteintech is a Polyclonal antibody targeting TMOD1 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples\n10145-1-AP targets TMOD1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C2C12 cells, mouse brain tissue,  mouse heart tissue,  rat heart tissue,  mouse skeletal muscle,  rat brain\nPositive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nActin filaments control cell morphology. The length of these filaments is regulated in muscle and nonmuscle cell types by tropomodulins 1-4 (Tmod1-4), a family of proteins that cap the pointed ends of actin filaments. The molecular weight of Tmod 1 is about 40 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0192 Product name: Recombinant human TMOD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 105-359 aa of BC002660 Sequence: PVLESVTLEPELEEALANASDAELCDIAAILGMHTLMSNQQYYQALSSSSIMNKEGLNSVIKPTQYKPVPDEEPNSTDVEETLERIKNNDPKLEEVNLNNIRNIPIPTLKAYAEALKENSYVKKFSIVGTRSNDPVAYALAEMLKENKVLKTLNVESNFISGAGILRLVEALPYNTSLVEMKIDNQSQPLGNKVEMEIVSMLEKNATLLKFGYHFTQQGPRLRASNAMMNNNDLVRKRRLADLTGPIIPKCRSGV Predict reactive species\nFull Name: tropomodulin 1\nCalculated Molecular Weight: 41 kDa\nObserved Molecular Weight: 41 kDa\nGenBank Accession Number: BC002660\nGene Symbol: TMOD1\nGene ID (NCBI): 7111\nRRID: AB_2205316\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P28289\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868990525609,"sku":"10145-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10145-1-ap","provider":"Iright","version":"1.0","type":"link"}