{"product_id":"proteintech-10162-1-ap","title":"Proteintech, 10162-1-AP, C17orf81 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C17orf81 (10162-1-AP) by Proteintech is a Polyclonal antibody targeting C17orf81 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n10162-1-AP targets C17orf81 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, HEK-293 cells,  K-562 cells\nPositive IHC detected in: mouse heart tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nELP5, also named as C17orf81, DERP6 and S-phase 2 protein, acts as subunit of the RNA polymerase II elongator complex. It's involved in TP53-mediated transcriptional regulation. ELP5 has some isoforms with MW 20 kDa, 30 kDa and 34-37 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0194 Product name: Recombinant human C17orf81 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-209 aa of BC002762 Sequence: MTPSEGARAGTGRELEMLDSLLALGGLVLLRDSVEWEGRSLLKALVKKSALCGEQVHILGCEVSEEEFREGFDSDINNRLVYHDFFRDPLNWSKTEEAFPGGPLGALRAMCKRTDPVPVTIALDSLSWLLLRLPCTTLCQVLHAVSHQDSCPGDSSSVGKVSVLGLLHEELHGPGPVGALSSLAQTEVTLGGTMGQASAHILCRRPRQR Predict reactive species\nFull Name: chromosome 17 open reading frame 81\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 37 and 45 kDa\nGenBank Accession Number: BC002762\nGene Symbol: C17orf81\nGene ID (NCBI): 23587\nRRID: AB_2274975\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TE02\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869645492393,"sku":"10162-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10162-1-ap","provider":"Iright","version":"1.0","type":"link"}