{"product_id":"proteintech-10168-2-ap","title":"Proteintech, 10168-2-AP, ACSM3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ACSM3 (10168-2-AP) by Proteintech is a Polyclonal antibody targeting ACSM3 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n10168-2-AP targets ACSM3 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, HEK-293 cells,  rat kidney tissue\nPositive IHC detected in: human colon cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSA hypertension-associated rat homolog (SAH, synonym: SA) is expressed at 10-fold greater levels in the kidney of the spontaneously hypertensive rat than in the corresponding wild-type strain. The gene is linked to blood pressure levels in a number of crosses involving the spontaneously hypertensive rat and other strains of genetically hypertensive rats. Human SAH gene polymorphism may be associated with the renal prognosis of immunoglobulin A nephropathy through its effect on blood pressure. Furthermore, variation in SAH has a role in predisposition.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0224 Product name: Recombinant human ACSM3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-320 aa of BC002790 Sequence: MLARVTRKMLRHAKCFQRLAIFGSVRALHKDNRTATPQNFSNYESMKQDFKLGIPEYFNFAKDVLDQWTDKEKAGKKPSNPAFWWINRNGEEMRWSFEELGSLSRKFANILSEACSLQRGDRVILILPRVPEWWLANVACLRTGTVLIPGTTQLTQKDILYRLQSSKANCIITNDVLAPAVDAVASKCENLHSKLIVSENSREGWGNLKELMKHASDSHTCVKTKHNEIMAIFFTSGTSGYPKMTAHTHSSFGLGLSVNGRFWLDLTPSDVMWNTSDTGWAKSAWSSVFSPWIQGACVFTHHLPRFEPTSILQTLSKYPI Predict reactive species\nFull Name: acyl-CoA synthetase medium-chain family member 3\nCalculated Molecular Weight: 49 kDa, 66 kDa\nObserved Molecular Weight: 60-70 kDa\nGenBank Accession Number: BC002790\nGene Symbol: ACSM3\nGene ID (NCBI): 6296\nRRID: AB_2222699\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q53FZ2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868962345129,"sku":"10168-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10168-2-ap","provider":"Iright","version":"1.0","type":"link"}