{"product_id":"proteintech-10174-1-ap","title":"Proteintech, 10174-1-AP, NKIRAS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NKIRAS2 (10174-1-AP) by Proteintech is a Polyclonal antibody targeting NKIRAS2 in WB, IF\/ICC, IP, ELISA applications with reactivity to human samples\n10174-1-AP targets NKIRAS2 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  HepG2 cells\nPositive IP detected in: HEK-293 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nI-Kappa-B-interacting Ras-like protein 2 (KBRAS2, MGC:4553), interact with the PEST domains of IkappaBalpha and IkappaBbeta [inhibitors of the transcription factor nuclear factor kappa B (NF-kappaB)] and decrease their rate of degradation. KBRAS2 differs from other Ras proteins in containing Ala and Leu residues at positions 12 and 61 respectively, which are similar to those present in the oncogenic forms of Ras.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0221 Product name: Recombinant human NKIRAS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-191 aa of BC007450 Sequence: MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAELPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG Predict reactive species\nFull Name: NFKB inhibitor interacting Ras-like 2\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC007450\nGene Symbol: NKIRAS2\nGene ID (NCBI): 28511\nRRID: AB_2298444\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NYR9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869476868265,"sku":"10174-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10174-1-ap","provider":"Iright","version":"1.0","type":"link"}