{"product_id":"proteintech-10198-1-ap","title":"Proteintech, 10198-1-AP, Caspase 6\/P18\/P11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Caspase 6\/P18\/P11 (10198-1-AP) by Proteintech is a Polyclonal antibody targeting Caspase 6\/P18\/P11 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10198-1-AP targets Caspase 6\/P18\/P11 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Staurosporine treated Jurkat cells, mouse brain tissue,  Jurkat cells\nPositive IHC detected in: human lung cancer tissue, human prostate cancer tissue,  human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCaspase-6 belongs to caspase family of cysteinyl-aspartate specific proteases.Precursor of CASP6 produces two subunits, large (18kDa) and small (16kDa) that dimerize. It cleaves poly(ADP-ribose) polymerase, as well as lamins and is involved in the activation cascade of caspases responsible for apoptosis execution. Researches showed that CASP6 could be an early instigator of neuronal dysfunction and regulates B cell activation and differentiation into plasma cells by modifying cell cycle entry. IRAK3 is an important target for CASP6. It can reveal five bands of 28, 32, 36, 49, and 64 kDa in human neurons and fetal brain in western blot, the 32 and 28 kDa bands represent procaspase-6 and pro-arm caspase-6. Procaspase-6 is more abundant than pro-arm caspase-6 in adult tissue, whereas pro-arm caspase-6 is more abundant than pro-caspase-6 in fetal brain and cultured neurons. The higher molecular mass bands at 49 and 64 kDa likely represent dimers of p28 and p32.(PMID:10438520). In rat testis, it can be detected two bands of 34 kDa and 12 kDa or 14 kDa(PMID:12538628).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0257 Product name: Recombinant human Caspase 6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 59-222 aa of BC000305 Sequence: LTLPERRGTCADRDNLTRRFSDLGFEVKCFNDLKAEELLLKIHEVSTVSHADADCFVCVFLSHGEGNHIYAYDAKIEIQTLTGLFKGDKCHSLVGKPKIFIIQACRGNQHDVPVIPLDVVDNQTEKLDTNITEVDAASVYTLPAGADFLMCYSVAEGYYSHRET Predict reactive species\nFull Name: caspase 6, apoptosis-related cysteine peptidase\nCalculated Molecular Weight: 33 kDa, 22 kDa\nObserved Molecular Weight: 33-35 kDa\nGenBank Accession Number: BC000305\nGene Symbol: Caspase 6\nGene ID (NCBI): 839\nRRID: AB_2259380\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P55212\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868910571689,"sku":"10198-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10198-1-ap","provider":"Iright","version":"1.0","type":"link"}