{"product_id":"proteintech-10208-1-ap","title":"Proteintech, 10208-1-AP, EFTUD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EFTUD2 (10208-1-AP) by Proteintech is a Polyclonal antibody targeting EFTUD2 in WB, IF\/ICC, IP, ELISA applications with reactivity to human samples\n10208-1-AP targets EFTUD2 in WB, IHC, IF\/ICC, IP, CoIP, RIP, ELISA, PLA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEFTUD2 encodes the 116 kDa U5 small nuclear ribonecleoprotein (snRNP) component, also named SNU114, it has GTP binding activity and is required for pre-mRNA splicing. Evolutionarily conserved human snRNP protein (U5-116kDa) is homologous to the ribosomal elongation factor EF-2 (ribosomal translocase). Defects in EFTUD2 are the cause of mandibulofacial dysostosis with microcephaly (MFDM). So far, acetylation and phosphorylation sites of EFTUD2 have been identified. Catolog#10208-1-AP is a rabbit polyclonal antibody raised against the N-terminal of human EFTUD2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0279 Product name: Recombinant human EFTUD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 13-217 aa of BC002360 Sequence: IGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTA Predict reactive species\nFull Name: elongation factor Tu GTP binding domain containing 2\nCalculated Molecular Weight: 116 kDa\nObserved Molecular Weight: 116 kDa\nGenBank Accession Number: BC002360\nGene Symbol: EFTUD2\nGene ID (NCBI): 9343\nRRID: AB_2095834\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15029\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868884160681,"sku":"10208-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10208-1-ap","provider":"Iright","version":"1.0","type":"link"}