{"product_id":"proteintech-10214-1-ig","title":"Proteintech, 10214-1-Ig, TSC22D1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TSC22D1 (10214-1-Ig) by Proteintech is a Polyclonal antibody targeting TSC22D1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, rat samples\n10214-1-Ig targets TSC22D1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue,  A549 cells,  rat brain tissue\nPositive IP detected in: rat brain tissue\nPositive IHC detected in: human brain tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTSC22 domain family 1, transforming growth factor beta 1 induced transcript 4, (TSC22D1, synonyms: TSC22, TGFB1I4, MGC17597) is a member of a family of leucine zipper containing transcription factors with repressor activity  and belongs to the large family of early response genes. TSC-22 regulates cell growth and differentiation, and cell death. Leucine zipper structure of TSC22 inhibits the anchorage independent growth of cancer cells. TSC-22 is also an important downstream component of peroxisome proliferator-activated receptor  (PPAR) and TGF-beta signaling during intestinal epithelial cell differentiation. This antibody is a rabbit polyclonal antibody raised against an internal region of human TSC22D1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0287 Product name: Recombinant human TSC22D1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-144 aa of BC000456 Sequence: KSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA Predict reactive species\nFull Name: TSC22 domain family, member 1\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 16 kDa\nGenBank Accession Number: BC000456\nGene Symbol: TSC22D1\nGene ID (NCBI): 8848\nRRID: AB_2272193\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q15714\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868946190505,"sku":"10214-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10214-1-ig","provider":"Iright","version":"1.0","type":"link"}