{"product_id":"proteintech-10231-1-ap","title":"Proteintech, 10231-1-AP, SMAD4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SMAD4 (10231-1-AP) by Proteintech is a Polyclonal antibody targeting SMAD4 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10231-1-AP targets SMAD4 in WB, IHC, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, COLO 320 cells,  HEK-293 cells,  mouse liver tissue,  NIH\/3T3 cells,  HCT 116 cells,  Neuro-2a cells,  C6 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human skin cancer tissue, human tonsillitis tissue,  human cervical cancer tissue,  mouse pancreas tissue,  rat small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMammalian homologs of the Drosophila Mad gene include Smad1, Smad2, Smad3, Smad4 (DPC4), Smad5, Smad6, Smad7 and Smad8.  Smad1 and Smad5 are effectors of BMP2 and BMP4 function while Smad2 and Smad3 are involved in TGF  and activin-mediated growth modulation. Smad4 has been shown to mediate all of the above activities through interaction with various Smad family members . Smad6 and Smad7 regulate the response to activin\/ TGF  signaling by interfering with TGF -mediated phosphorylation of other Smad family members. This antibody is a rabbit polyclonal antibody raised against an internal region of human SMAD4.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, bovine, hamster, sheep, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0299 Product name: Recombinant human SMAD4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 13-227 aa of BC002379 Sequence: NDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPAS Predict reactive species\nFull Name: SMAD family member 4\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 63-70 kDa\nGenBank Accession Number: BC002379\nGene Symbol: SMAD4\nGene ID (NCBI): 4089\nRRID: AB_2193323\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13485\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868822360233,"sku":"10231-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10231-1-ap","provider":"Iright","version":"1.0","type":"link"}