{"product_id":"proteintech-10232-1-ap","title":"Proteintech, 10232-1-AP, ARL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARL2 (10232-1-AP) by Proteintech is a Polyclonal antibody targeting ARL2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10232-1-AP targets ARL2 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue,  HeLa cells,  mouse lung tissue,  mouse spleen tissue,  Y79 cells\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe ADP-ribosylation factor (ARF) genes are small GTP-binding proteins of the RAS superfamily.  ADP-ribosylation factor-like 2 (ARL2) is a member of a functionally distinct group of ARF-like genes. ARL2 interacts with the tubulin-specific chaperone protein known as cofactor D. ARL2 downregulates the tubulin GAP activity of cofactor C, D, and E, and inhibits the binding of D to native tubulin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0334 Product name: Recombinant human ARL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-184 aa of BC002530 Sequence: GLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATLLIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD Predict reactive species\nFull Name: ADP-ribosylation factor-like 2\nCalculated Molecular Weight: 21 kDa\nObserved Molecular Weight: 21-25 kDa\nGenBank Accession Number: BC002530\nGene Symbol: ARL2\nGene ID (NCBI): 402\nRRID: AB_2034885\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P36404\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868977057961,"sku":"10232-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10232-1-ap","provider":"Iright","version":"1.0","type":"link"}