{"product_id":"proteintech-10234-2-ap","title":"Proteintech, 10234-2-AP, Transgelin 2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Transgelin 2 (10234-2-AP) by Proteintech is a Polyclonal antibody targeting Transgelin 2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n10234-2-AP targets Transgelin 2 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HEK-293 cells\nPositive IHC detected in: human skin cancer tissue, human colon cancer tissue,  human intrahepatic cholangiocarcinoma tissue,  human ovary cancer tissue,  human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe transgelin family is a group of proteins that belong to  22 kDa actin-related corpnin superfamily. Of all three isoforms, transgelin 1 is the best characterized. Transgelin 1, also known as SM22 alpha, is a specific marker for differentiated smooth muscle cells. Transgelin 2, also known as SM22 beta, is expressed by both smooth muscle and non-smooth muscle cells in a temporally and spatially regulated pattern. Trangenlin 3, also known as NP25, is only found in highly differentiated neuronal cells. This antibody was generated against full length transgenlin 2 protein. It may cross react with other two transgelins based on the sequence similarity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0337 Product name: Recombinant human TAGLN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4-130 aa of BC002616 Sequence: RGPAYGLSREVQQKIEKQYDADLEQILIQWITTQCRKDVGRPQPGRENFQNWLKDGTVLCELINAQYPEGQAPVKKIQASTMAFKQMEQISQFLQAAERYGINTTDIFQTVDLWEGKNMACVQRTLM Predict reactive species\nFull Name: transgelin 2\nCalculated Molecular Weight: 199 aa, 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC002616\nGene Symbol: Transgelin-2\/TAGLN2\nGene ID (NCBI): 8407\nRRID: AB_2240241\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P37802\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868872691881,"sku":"10234-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10234-2-ap","provider":"Iright","version":"1.0","type":"link"}