{"product_id":"proteintech-10235-1-ap","title":"Proteintech, 10235-1-AP, MTCP1NB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MTCP1NB (10235-1-AP) by Proteintech is a Polyclonal antibody targeting MTCP1NB in IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n10235-1-AP targets MTCP1NB in IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: HEK-293T cells\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMTCP1NB, also named as C6.1B, MTCP1, MTCP1B, is a member of the CMC4 protein family. MTCP1NB is 8 kDa protein that localizes to mitochondria. MTCP1NB was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations(NCBI).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0338 Product name: Recombinant human MTCP1NB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-68 aa of BC002600 Sequence: PCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK Predict reactive species\nFull Name: mature T-cell proliferation 1 neighbor\nCalculated Molecular Weight: 13 kDa, 8 kDa\nObserved Molecular Weight: 8 kDa\nGenBank Accession Number: BC002600\nGene Symbol: MTCP1NB\nGene ID (NCBI): 100272147\nRRID: AB_2189123\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P56277\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887726252201,"sku":"10235-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10235-1-ap","provider":"Iright","version":"1.0","type":"link"}