{"product_id":"proteintech-10242-1-ap","title":"Proteintech, 10242-1-AP, CYC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CYC1 (10242-1-AP) by Proteintech is a Polyclonal antibody targeting CYC1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n10242-1-AP targets CYC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human brain tissue\nPositive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCYC1, also named as Cytochrome c-1, belongs to the cytochrome c family. Cytochrome c1 is one respiratory subunit of the 11 subunits of the cytochrome bc1 complex of the mitochondrial electron-transfer chain. It mediates the transfer of an electron from Rieske iron-sulfur protein to cytochrome c(PMID:3036122 ). CYC1 mediates apoptosis. In this pathway, a variety of apoptotic stimuli cause CYC1 release from mitochondria, which in turn induces a series of biochemical reactions that result incaspase activation and subsequent cell death.(PMID:15189137) While CYC1 release and DNA fragmentation are unaffected by the noncleavablep75 mutant, mitochondrial morphology of dying cells is maintained, and loss of plasma membrane integrity is delayed(PMID:15186778). The protein migrated as a 35 kd band in SDS page.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, pig, monkey\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0291 Product name: Recombinant human CYC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 46-271 aa of BC001006 Sequence: ALSSKSGLSRGRKVMLSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVC Predict reactive species\nFull Name: cytochrome c-1\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC001006\nGene Symbol: CYC1\nGene ID (NCBI): 1537\nRRID: AB_2090144\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08574\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868850671785,"sku":"10242-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10242-1-ap","provider":"Iright","version":"1.0","type":"link"}