{"product_id":"proteintech-10263-1-ap","title":"Proteintech, 10263-1-AP, PIR Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PIR (10263-1-AP) by Proteintech is a Polyclonal antibody targeting PIR in WB, IHC, IP, ELISA applications with reactivity to human samples\n10263-1-AP targets PIR in WB, IHC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells,  HeLa cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPirin (iron-binding nuclear protein, PIR) is a highly conserved 32-kDa protein consisting of 290 amino acids. Pirin mRNA is expressed weakly in all human tissues.  Confocal immunofluorescence experiments demonstrate a predominant localization of Pirin within dot-like subnuclear structures. Pirin interacts with the oncoprotein B-cell lymphoma 3-encoded (Bcl-3) and nuclear factor I (NFI).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0330 Product name: Recombinant human PIR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 46-230 aa of BC002517 Sequence: KGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVEN Predict reactive species\nFull Name: pirin (iron-binding nuclear protein)\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC002517\nGene Symbol: PIR\nGene ID (NCBI): 8544\nRRID: AB_2283879\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00625\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869730754729,"sku":"10263-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10263-1-ap","provider":"Iright","version":"1.0","type":"link"}