{"product_id":"proteintech-10264-1-ap","title":"Proteintech, 10264-1-AP, IL-11RA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-11RA (10264-1-AP) by Proteintech is a Polyclonal antibody targeting IL-11RA in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10264-1-AP targets IL-11RA in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue\nPositive IHC detected in: human prostate cancer tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: N2a cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-11 (IL-11), a member of the IL-6 family of cytokines, was firstly identified in bone marrow-derived stromal cells (PMID: 2145578). IL-11 is a multifunctional cytokine that plays important roles in hematopoiesis, bone development, tissue repair, and tumor development (PMID: 33863879). IL-10 signals through a receptor complex consisting of IL-11 receptor alpha subunit (IL-11RA) and gp130. IL-11RA binds IL-11 and gp130 transmits signals to the nucleus via Janus kinase (JAK) activation. In addition to a membrane-bound form, IL-11RA can also exist as a soluble form (sIL-11RA) that acts as an agonist of IL-11 activity (PMID: 26876177; 27493449).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0373 Product name: Recombinant human IL-11RA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 184-361 aa of BC003110 Sequence: GAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPCQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHRD Predict reactive species\nFull Name: interleukin 11 receptor, alpha\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: BC003110\nGene Symbol: IL11RA\nGene ID (NCBI): 3590\nRRID: AB_2125660\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14626\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869550858409,"sku":"10264-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10264-1-ap","provider":"Iright","version":"1.0","type":"link"}