{"product_id":"proteintech-10274-1-ap","title":"Proteintech, 10274-1-AP, TAU Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TAU (10274-1-AP) by Proteintech is a Polyclonal antibody targeting TAU in WB, IHC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat samples\n10274-1-AP targets TAU in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain\nPositive IHC detected in: human brain tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse brain tissue\nPositive IF-Fro detected in: mouse brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTau (tubulin-associated unit) is a microtubule-associated protein (also known as MAPT), expressed mainly in neurons of the central nervous system. Its primary function is to modulate microtubule dynamics for maintaining axonal cytoskeleton. Various isoforms of Tau exist due to the alternative splicing, and short isoforms around 45-69 kDa and long isoforms around 100-110 kDa have been reported in different literature (8752131,15965697). Present polyclonal anti-Tau antibody was produced by immunizing animals with N-terminal of Tau and can detect approx 45-70 kDa and 100-kDa bands in brain tissues.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0354 Product name: Recombinant human TAU protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 5-208 aa of BC000558 Sequence: PRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENL Predict reactive species\nFull Name: microtubule-associated protein tau\nCalculated Molecular Weight: 37-46, 79-81 kDa\nObserved Molecular Weight: 45-70 kDa, 100 kDa\nGenBank Accession Number: BC000558\nGene Symbol: TAU\nGene ID (NCBI): 4137\nRRID: AB_2139718\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10636\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868841332905,"sku":"10274-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10274-1-ap","provider":"Iright","version":"1.0","type":"link"}