{"product_id":"proteintech-10292-1-ap","title":"Proteintech, 10292-1-AP, calreticulin Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe calreticulin (10292-1-AP) by Proteintech is a Polyclonal antibody targeting calreticulin in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n10292-1-AP targets calreticulin in WB, IHC, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HL-60 cells, A549 cells,  mouse brain tissue,  COLO 320 cells,  NIH\/3T3 cells,  human skeletal muscle tissue,  rat brain tissue,  HeLa cells,  HepG2 cells,  MCF-7 cells,  SH-SY5Y cells\nPositive IHC detected in: human thyroid tissue, human normal colon,  human skeletal muscle tissue,  human thyroid cancer tissue,  mouse colon tissue,  mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCALR,also named as grp60, ERp60, HACBP, CRP55, CRTC and Calregulin, belongs to the calreticulin family. It is a molecular calcium-binding chaperone promoting folding, oligomeric assembly and quality control in the ER via the calreticulin\/calnexin cycle. CALR is a ER marker. It interacts transiently with almost all of the monoglucosylated glycoproteins that are synthesized in the ER. CALR interacts with the DNA-binding domain of NR3C1 and mediates its nuclear export. The MW of CALR migrates aberrantly at 55 kDa by SDS-PAGE. Some study provided that it's a new possibility for CRT-mediated tumor immune prevention and treatment.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0325 Product name: Recombinant human calreticulin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC002500 Sequence: MLLSVPLLLGLLGLAVAEPAVYFKEQFLDGDGWTSRWIESKHKSDFGKFVLSSGKFYGDEEKDKGLQTSQDARFYALSASFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPNSLDQTDMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDW Predict reactive species\nFull Name: calreticulin\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC002500\nGene Symbol: Calreticulin\nGene ID (NCBI): 811\nRRID: AB_2069615\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P27797\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868826947753,"sku":"10292-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10292-1-ap","provider":"Iright","version":"1.0","type":"link"}