{"product_id":"proteintech-10309-1-ap","title":"Proteintech, 10309-1-AP, GPRC5A,RAI3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPRC5A,RAI3 (10309-1-AP) by Proteintech is a Polyclonal antibody targeting GPRC5A,RAI3 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n10309-1-AP targets GPRC5A,RAI3 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells, MCF-7 cells,  HeLa cells,  RAW 264.7 cells\nPositive IHC detected in: human lung cancer tissue, human breast cancer tissue,  human colon cancer tissue,  human lung squamous cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPRC5A, also named as GPCR5A, RAI3 and RAIG1, belongs to the G-protein coupled receptor 3 family. It is an orphan G-protein coupled receptor (GPCR) that has been associated with malignancy and may play a role in the proliferation of breast cancer cells. GPRC5A is a potential molecular target for treatment of breast cancers. It is suppressed in some human lung carcinoma cells. (PMID:15788639, 20563252, 19552806 )\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, goat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0311 Product name: Recombinant human GPRC5A,RAI3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 106-330 aa of BC003665 Sequence: SICFSCLLAHAVSLTKLVRGRKPLSLLVILGLAVGFSLVQDVIAIEYIVLTMNRTNVNVFSELSAPRRNEDFVLLLTYVLFLMALTFLMSSFTFCGSFTGWKRHGAHIYLTMLLSIAIWVAWITLLMLPDFDRRWDDTILSSALAANGWVFLLAYVSPEFWLLTKQRNPMDYPVEDAFCKPQLVKKSYGVENRAYSQEEITQGFEETGDTLYAPYSTHFQLQNQP Predict reactive species\nFull Name: G protein-coupled receptor, family C, group 5, member A\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 40-45 kDa\nGenBank Accession Number: BC003665\nGene Symbol: GPRC5A\nGene ID (NCBI): 9052\nRRID: AB_2877732\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NFJ5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868833271977,"sku":"10309-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10309-1-ap","provider":"Iright","version":"1.0","type":"link"}