{"product_id":"proteintech-10316-1-ap","title":"Proteintech, 10316-1-AP, WBP11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe WBP11 (10316-1-AP) by Proteintech is a Polyclonal antibody targeting WBP11 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10316-1-AP targets WBP11 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse heart tissue\nPositive IP detected in: mouse heart tissue\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWBP11 (WW domain-binding protein 11) is a protein that in humans, is encoded by the WBP11 gene. The function of WBP11 is to play a role in the regulation of pre-mRNA processing. More specifically, this nuclear protein, colocalizes with mRNA splicing factors and intermediate filament-containing perinuclear networks. The predicted MW of this protein is 70 kDa, and this antibody specially recognises the 70 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0366 Product name: Recombinant human WBP11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 170-379 aa of BC001621 Sequence: TSAYGPPTRAVSILPLLGHGVPRLPPGRKPPGPPPGPPPPQVVQMYGRKVGFALDLPPRRRDEDMLYSPELAQRGHDDDVSSTSEDDGYPEDMDQDKHDDSTDDSDTDKSDGESDGDEFVHRDNGERDNNEEKKSGLSVRFADMPGKSRKKKKNMKELTPLQAMMLRMAGQEIPEEGREVEEFSEDDDEDDSDDSEAEKQSQKQHKEESH Predict reactive species\nFull Name: WW domain binding protein 11\nCalculated Molecular Weight: 70 kDa\nObserved Molecular Weight: 66-70 kDa\nGenBank Accession Number: BC001621\nGene Symbol: WBP11\nGene ID (NCBI): 51729\nRRID: AB_10694664\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y2W2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887921516713,"sku":"10316-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10316-1-ap","provider":"Iright","version":"1.0","type":"link"}