{"product_id":"proteintech-10319-1-ap","title":"Proteintech, 10319-1-AP, EIF3B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EIF3B (10319-1-AP) by Proteintech is a Polyclonal antibody targeting EIF3B in WB, IP, ELISA applications with reactivity to human samples\n10319-1-AP targets EIF3B in WB, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells\nPositive IP detected in: A375 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEIF3B, also named as Eukaryotic translation initiation factor 3 subunit B, is a 814 amino acid protein, which contains 1 RRM (RNA recognition motif) domain and 8 WD repeats and belongs to the eIF-3 subunit B family. EIF3B as a RNA-binding component of the eukaryotic translation initiation factor 3 (eIF-3) complex, is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression. \nThe calculated molecular weight of EIF3B is 93 kDa, but the phosphorylated EIF3B protein is about 115 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0386 Product name: Recombinant human EIF3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 381-562 aa of BC001173 Sequence: FSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHCESSAHWPIFKWSHDGKFFARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQLPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVDVVEMK Predict reactive species\nFull Name: eukaryotic translation initiation factor 3, subunit B\nCalculated Molecular Weight: 93 kDa\nObserved Molecular Weight: 115 kDa\nGenBank Accession Number: BC001173\nGene Symbol: EIF3B\nGene ID (NCBI): 8662\nRRID: AB_2096732\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P55884\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868917026985,"sku":"10319-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10319-1-ap","provider":"Iright","version":"1.0","type":"link"}