{"product_id":"proteintech-10324-1-ap","title":"Proteintech, 10324-1-AP, MYL12B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MYL12B (10324-1-AP) by Proteintech is a Polyclonal antibody targeting MYL12B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10324-1-AP targets MYL12B in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skeletal muscle tissue, mouse heart tissue,  rat skeletal muscle tissues\nPositive IHC detected in: human colon tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMYL12B is a regulatory subunit of myosin and plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. There are two groups of residues on the MYL12B that are phosphorylated by distinct kinases and have contrasting effects on myosin II biophysical properties.Phosphorylation at Thr18\/Ser19 essentially \"activates\" the myosin molecule to produce force. The second group of phosphorylated residues is at the N-terminus of the MYL12B at Ser1, Ser2 and Thr9 and causes inhibitory effect on myosin activity.(PMID: 22136066)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, frog\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0398 Product name: Recombinant human MYL12B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-172 aa of BC004994 Sequence: ATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD Predict reactive species\nFull Name: myosin, light chain 12B, regulatory\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 18-20 kDa\nGenBank Accession Number: BC004994\nGene Symbol: MYL12B\nGene ID (NCBI): 103910\nRRID: AB_2166830\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O14950\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868935049385,"sku":"10324-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10324-1-ap","provider":"Iright","version":"1.0","type":"link"}