{"product_id":"proteintech-10333-1-ap","title":"Proteintech, 10333-1-AP, CHRNA3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nCHRNA3 Polyclonal Antibody for WB, IHC, ELISA\n10333-1-AP targets CHRNA3 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, mouse brain tissue,  HepG2 cells,  mouse thymus tissue,  HEK-293 cells\nPositive IHC detected in: mouse brain tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCHRNA3, also named as NACHRA3, LNCR2 and PAOD2, is neuronal type nAChR subunits. It is a member of the nicotinic acetylcholine receptor family, which plays an important role in calcium regulation, neuronal development, and cognitive functions. Polymorphisms in this gene have been associated with an increased risk of smoking initiation and an increased susceptibility to lung cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, zebrafish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0272 Product name: Recombinant human CHRNA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 33-238 aa of BC000513 Sequence: EAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIR Predict reactive species\nFull Name: cholinergic receptor, nicotinic, alpha 3\nCalculated Molecular Weight: 57 kDa\nObserved Molecular Weight: 50-55 kDa\nGenBank Accession Number: BC000513\nGene Symbol: CHRNA3\nGene ID (NCBI): 1136\nRRID: AB_2080511\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P32297\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868939636905,"sku":"10333-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10333-1-ap","provider":"Iright","version":"1.0","type":"link"}