{"product_id":"proteintech-10337-1-ap","title":"Proteintech, 10337-1-AP, MAD2L1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MAD2L1 (10337-1-AP) by Proteintech is a Polyclonal antibody targeting MAD2L1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10337-1-AP targets MAD2L1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, rat liver tissue,  HEK-293 cells,  HepG2 cells,  Raji cells,  THP-1 cells,  HeLa cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: mouse ovary tissue, human liver cancer tissue,  human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMAD2 mitotic arrest deficient-like 1 (yeast) (MAD2L1, synonyms: MAD2, HSMAD2) is a component of the mitotic spindle assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate.  MAD2L1 is localized to human chromosome band 5q23.3 by in situ hybridization.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0307 Product name: Recombinant human MAD2L1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-185 aa of BC000356 Sequence: SAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRLRS Predict reactive species\nFull Name: MAD2 mitotic arrest deficient-like 1 (yeast)\nCalculated Molecular Weight: 24 kDa\nObserved Molecular Weight: 25-30 kDa\nGenBank Accession Number: BC000356\nGene Symbol: MAD2L1\nGene ID (NCBI): 4085\nRRID: AB_2139365\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13257\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868855521449,"sku":"10337-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10337-1-ap","provider":"Iright","version":"1.0","type":"link"}