{"product_id":"proteintech-10344-1-ap","title":"Proteintech, 10344-1-AP, UBE3A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UBE3A (10344-1-AP) by Proteintech is a Polyclonal antibody targeting UBE3A in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10344-1-AP targets UBE3A in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, mouse brain tissue,  mouse lung tissue,  Jurkat cells,  NIH\/3T3 cells,  C6 cells\nPositive IP detected in: K-562 cells\nPositive IHC detected in: human thyroid cancer tissue, human kidney tissue,  mouse lung tissue,  rat liver tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUBE3A(Ubiquitin-protein ligase E3A) is also named as E6AP, EPVE6AP, HPVE6A and belongs to the E3 ubiquitin protein ligase family. It functions as both an E3 ligase in the ubiquitin proteasome pathway and as a transcriptional coactivator. It is also initially identified as a cellular protein that mediates in vitro association of the human papillomavirus E6 protein with p53, leading to the ubiquitin-dependent degradation of p53(PMID:1661671). Defects in UBE3A are a cause of Angelman syndrome (AS)(PMID:10508479). It has 3 isoforms with MW of 97-101 kDa produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0346 Product name: Recombinant human UBE3A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 9-215 aa of BC002582 Sequence: GEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARIDFKDVTYLTEEKVYEILELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQAKDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSS Predict reactive species\nFull Name: ubiquitin protein ligase E3A\nCalculated Molecular Weight: 852 aa, 98 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC002582\nGene Symbol: UBE3A\nGene ID (NCBI): 7337\nRRID: AB_2211801\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q05086\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868904476841,"sku":"10344-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10344-1-ap","provider":"Iright","version":"1.0","type":"link"}