{"product_id":"proteintech-10352-1-ap","title":"Proteintech, 10352-1-AP, SNRPD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SNRPD1 (10352-1-AP) by Proteintech is a Polyclonal antibody targeting SNRPD1 in WB, ELISA applications with reactivity to human samples\n10352-1-AP targets SNRPD1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  HL-60 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSystemic lupus erythematosus is characterized by antibodies to a variety of intracellular self-antigens, such as dsDNA and Sm, and these serve as hallmarks in the diagnosis of systemic autoimmune diseases. SNRPD1 is one Sm components of the small nuclear ribonucleoprotein complexes(snRNPs). It's a charged protein scaffold to promote snRNP assembly or strengthen snRNP-snRNP interactions through nonspecific electrostatic contacts with RNA. This antibody detectes 13-16 kDa (SMD1) and 30 kDa (SMD1\/SMD2 dimer form; PMID:15525645).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0364 Product name: Recombinant human SNRPD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC001721 Sequence: MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR Predict reactive species\nFull Name: small nuclear ribonucleoprotein D1 polypeptide 16kDa\nCalculated Molecular Weight: 16 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC001721\nGene Symbol: SNRPD1\nGene ID (NCBI): 6632\nRRID: AB_2193875\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P62314\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868989509801,"sku":"10352-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10352-1-ap","provider":"Iright","version":"1.0","type":"link"}