{"product_id":"proteintech-10353-1-ap","title":"Proteintech, 10353-1-AP, PDE6B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDE6B (10353-1-AP) by Proteintech is a Polyclonal antibody targeting PDE6B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10353-1-AP targets PDE6B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse eye tissue, rat eye tissue\nPositive IHC detected in: mouse eye tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDE6 is a cGMP-specific PDE family and presents multicomponent enzyme complexes. The rod PDE6 enzyme is comprised of two catalytic subunits (PDE6A and PDE6B) and it is expressed in human lungs(PMID:20979602). PDE6B(Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta) is also named as PDEB and belongs to the cyclic nucleotide phosphodiesterase family. PDE6B also has a C-terminal CAAX motif for posttranslational processing involving lipidation, proteolysis, and carboxymethylation (PMID:8394243). Defects in PDE6B are the cause of retinitis pigmentosa type 40 (RP40)(PMID:22334370) and congenital stationary night blindness autosomal dominant type 2 (CSNBAD2)(PMID:8075643).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0365 Product name: Recombinant human PDE6B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 198-428 aa of BC000249 Sequence: GPFFTSEDEDVFLKYLNFATLYLKIYHLSYLHNCETRRGQVLLWSANKVFEELTDIERQFHKAFYTVRAYLNCERYSVGLLDMTKEKEFFDVWSVLMGESQPYSGPRTPDGREIVFYKVIDYILHGKEEIKVIPTPSADHWALASGLPSYVAESGFICNIMNASADEMFKFQEGALDDSGWLIKNVLSMPIVNKKEEIVGVATFYNRKDGKPFDEQDEVLMESLTQFLGWS Predict reactive species\nFull Name: phosphodiesterase 6B, cGMP-specific, rod, beta\nCalculated Molecular Weight: 98 kDa\nObserved Molecular Weight: 98 kDa\nGenBank Accession Number: BC000249\nGene Symbol: PDE6B\nGene ID (NCBI): 5158\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P35913\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869725642921,"sku":"10353-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10353-1-ap","provider":"Iright","version":"1.0","type":"link"}