{"product_id":"proteintech-10356-1-ap","title":"Proteintech, 10356-1-AP, GGA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GGA2 (10356-1-AP) by Proteintech is a Polyclonal antibody targeting GGA2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n10356-1-AP targets GGA2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, HeLa cells,  mouse adipose tissue,  human kidney tissue\nPositive IHC detected in: human colon cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGGA2, also known as VEAR, belongs to the GGA protein family and regulates the trafficking of proteins between the trans-Golgi network and the lysosome. GGA2 has an amino-terminal VHS domain in its N terminus which mediates sorting of the mannose 6-phosphate receptors at the trans-Golgi network. They also contain a carboxy-terminal region with homology to the ear domain of gamma-adaptins.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0370 Product name: Recombinant human GGA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 70-316 aa of BC000284 Sequence: KIQSPQEKEALYALTVLEMCMNHCGEKFHSEVAKFRFLNELIKVLSPKYLGSWATGKVKGRVIEILFSWTVWFPEDIKIRDAYQMLKKQGIIKQDPKLPVDKILPPPSPWPKSSIFDADEEKSKLLTRLLKSNHPEDLQAANRLIKNLVKEEQEKSEKVSKRVSAVEEVRSHVKVLQEMLSMYRRPGQAPPDQEALQVVYERCEKLRPTLFRLASDTTDDDDALAEILQANDLLTQGVLLYKQVMEG Predict reactive species\nFull Name: golgi associated, gamma adaptin ear containing, ARF binding protein 2\nCalculated Molecular Weight: 67 kDa\nObserved Molecular Weight: 67 kDa\nGenBank Accession Number: BC000284\nGene Symbol: GGA2\nGene ID (NCBI): 23062\nRRID: AB_2110735\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UJY4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869544698025,"sku":"10356-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10356-1-ap","provider":"Iright","version":"1.0","type":"link"}