{"product_id":"proteintech-10358-1-ap","title":"Proteintech, 10358-1-AP, DDX50 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDX50 (10358-1-AP) by Proteintech is a Polyclonal antibody targeting DDX50 in WB, IF\/ICC, IP, ELISA applications with reactivity to human samples\n10358-1-AP targets DDX50 in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells\nPositive IP detected in: HeLa cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DEAD box polypeptide 50 (DDX50, synonyms: GU2, GUB, MGC3199, RH-II\/GuB) enzyme may be involved in ribosomal RNA synthesis or processing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0382 Product name: Recombinant human DDX50 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 136-381 aa of BC000272 Sequence: EGAFSNFPISEETIKLLKGRGVTYLFPIQVKTFGPVYEGKDLIAQARTGTGKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFKDITRKLSVACFYGGTSYQSQINHIRNGIDILVGTPGRIKDHLQSGRLDLSKLRHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDNPQTLLFSATCPQWVYKVAKKYMKSRYEQVDLVGKMTQKAATTVEHLAIQCHWSQRPAVIGDV Predict reactive species\nFull Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 50\nCalculated Molecular Weight: 83 kDa\nObserved Molecular Weight: 83 kDa\nGenBank Accession Number: BC000272\nGene Symbol: DDX50\nGene ID (NCBI): 79009\nRRID: AB_2245834\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9BQ39\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868996620457,"sku":"10358-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10358-1-ap","provider":"Iright","version":"1.0","type":"link"}