{"product_id":"proteintech-10361-1-ap","title":"Proteintech, 10361-1-AP, BNIP2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BNIP2 (10361-1-AP) by Proteintech is a Polyclonal antibody targeting BNIP2 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n10361-1-AP targets BNIP2 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, MCF-7 cells,  MDA-MB-231 cells,  SW480 cells\nPositive IF\/ICC detected in: HeLa cells, RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBCL2\/adenovirus E1B 19 kDa protein-interacting protein 2 (BNIP2) is also named as PRKACN2. BNIP2 is developmentally regulated may suggest a role of this gene in those brain areas where the differentiation is orchestrated by estradiol. The expression of  BNIP2 was inhibited by estradiol. BNIP2 is implicated in the suppression of cell death and interacts with the BCL-2 and adenovirus E1B 19 kDa proteins. BNIP2 is highly expressed in patients with favorable neuroblastoma (NB) (PMID: 25611382).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0403 Product name: Recombinant human BNIP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 144-313 aa of BC002461 Sequence: MKAIEPYKKVISHGGYYGDGLNAIVVFAVCFMPESSQPNYRYLMDNLFKYVIGTLELLVAENYMIVYLNGATTRRKMPSLGWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLAVTRPFISSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQVDQELNGKQDEPKNE Predict reactive species\nFull Name: BCL2\/adenovirus E1B 19kDa interacting protein 2\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC002461\nGene Symbol: BNIP2\nGene ID (NCBI): 663\nRRID: AB_3085366\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q12982\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885261246633,"sku":"10361-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10361-1-ap","provider":"Iright","version":"1.0","type":"link"}