{"product_id":"proteintech-10364-1-ap","title":"Proteintech, 10364-1-AP, MAPRE2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MAPRE2 (10364-1-AP) by Proteintech is a Polyclonal antibody targeting MAPRE2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n10364-1-AP targets MAPRE2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, Jurkat cells\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HCT 116 cells, mouse cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRP1 protein shares significant homology to the adenomatous polyposis coli (APC) protein-binding EB1 gene family and binds specifically to the C-terminal region of the APC protein. RP1 also binds directly to tubulin, both in vitro and in vivo.  The function of RP1 is currently unknown; however, its homology suggests involvement in tumorigenesis of colorectal cancers and proliferative control of normal cells. It may belong to the intermediate\/early gene family, involved in the signal transduction cascade downstream of the TCR.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0416 Product name: Recombinant human MAPRE2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-327 aa of BC007318 Sequence: QTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYASEEHEGHTEEPEAEEQAHEQQPPQQEEY Predict reactive species\nFull Name: microtubule-associated protein, RP\/EB family, member 2\nCalculated Molecular Weight: 37 kDa\nObserved Molecular Weight: 39-42 kDa\nGenBank Accession Number: BC007318\nGene Symbol: MAPRE2\nGene ID (NCBI): 10982\nRRID: AB_2141649\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q15555\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869558231209,"sku":"10364-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10364-1-ap","provider":"Iright","version":"1.0","type":"link"}