{"product_id":"proteintech-10375-2-ap","title":"Proteintech, 10375-2-AP, MMP-9 (N-terminal) Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MMP-9 (N-terminal) (10375-2-AP) by Proteintech is a Polyclonal antibody targeting MMP-9 (N-terminal) in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n10375-2-AP targets MMP-9 (N-terminal) in WB, IHC, IF\/ICC, FC (Intra), CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HEK-293 cells,  LNCaP cells,  U2OS cells,  HepG2 cells,  Raji cells,  MDA-MB-231 cells\nPositive IHC detected in: human breast cancer tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, tissue remodeling, and disease processes, such as arthritis or metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. Matrix metalloproteinase 9 (gelatinase B, 92 kDa gelatinase, 92 kDa type IV collagenase) (MMP9, synonyms: GELB, CLG4B) degrades collagens type IV and V. Studies in rhesus monkeys suggest that MMP9 is involved in IL-8-induced mobilization hematopoietic progenitor cells from bone marrow, and murine studies suggest a role in tumor-associated tissue remodeling. The pro-MMP9 is 92 kDa, and it can be detected a processed form of 68 kDa. This protein can exist as a dimer of 180 kDa (PMID:7492685).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat, pig, rabbit, bovine, hamster, fish\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0552 Product name: Recombinant human MMP9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC006093 Sequence: MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCG Predict reactive species\nFull Name: matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)\nCalculated Molecular Weight: 707 aa, 78 kDa\nObserved Molecular Weight: 92 kDa, 67 kDa\nGenBank Accession Number: BC006093\nGene Symbol: MMP-9\nGene ID (NCBI): 4318\nRRID: AB_10897178\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P14780\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868816756905,"sku":"10375-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10375-2-ap","provider":"Iright","version":"1.0","type":"link"}