{"product_id":"proteintech-10394-1-ap","title":"Proteintech, 10394-1-AP, CFLAR\/FLIP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CFLAR\/FLIP (10394-1-AP) by Proteintech is a Polyclonal antibody targeting CFLAR\/FLIP in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n10394-1-AP targets CFLAR\/FLIP in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HepG2 cells,  HeLa cells\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: mouse skeletal muscle tissue, human skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCFLAR, also named CASH, CASP8AP1, CLARP, MRIT, Casper, c-FLIP, and I-FLICE, belongs to the peptidase C14A family. It is an apoptosis regulator protein that may function as a crucial link between cell survival and cell death pathways in mammalian cells. CFLAR acts as an inhibitor of TNFRSF6-mediated apoptosis. It can be cleaved to be 2 fragments P43 and P12. P43 is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full-length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. CFLAR lacks enzymatic (caspase) activity.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0593 Product name: Recombinant human CFLAR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-184 aa of BC001602 Sequence: DVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRN Predict reactive species\nFull Name: CASP8 and FADD-like apoptosis regulator\nCalculated Molecular Weight: 52 kDa\nObserved Molecular Weight: 20-35 kDa, 50-55 kDa\nGenBank Accession Number: BC001602\nGene Symbol: FLIP\nGene ID (NCBI): 8837\nRRID: AB_2081087\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O15519\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868932657321,"sku":"10394-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10394-1-ap","provider":"Iright","version":"1.0","type":"link"}