{"product_id":"proteintech-10398-1-ap","title":"Proteintech, 10398-1-AP, BAP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe BAP1 (10398-1-AP) by Proteintech is a Polyclonal antibody targeting BAP1 in WB, IHC, IP, ELISA applications with reactivity to human samples\n10398-1-AP targets BAP1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A2780 cells, human placenta tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human ovary tumor tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBRCA1-associated protein-1 (BAP1),also named as KIAA0272, hucep-6, DKFZp686N04275, FLJ35406, FLJ37180, HUCEP-13, is a deubiquitinating enzyme whose function in the control of the cell cycle requires both its deubiquitinating activity and nuclear localization(PMID:22374320). It helps to control cell proliferation by regulating HCFC1 protein levels and by associating with genes involved in the G(1)-S transition)(PMID:19188440). Defects in BAP1 may be a cause of mesothelioma malignant (MESOM)(PMID:21642991) and tumor predisposition syndrome (TPDS)(PMID:21874003). The all BAP1s except those of C. quinquefasciatus have a molecular mass of more than 90 kDa(PMID:22374320).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0597 Product name: Recombinant human BAP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-228 aa of BC001596 Sequence: LVEDFGVKGVQVEEIYDLQSKCQGPVYGFIFLFKWIEERRSRRKVSTLVDDTSVIDDDIVNNMFFAHQLIPNSCATHALLSVLLNCSSVDLGPTLSRMKDFTKGFSPESKGYAIGNAPELAKAHNSHARPEPRHLPEKQNGLSAVRTMEAFHFVSYVPITGRLFELDGLKVYPIDHGPWGEDEEWTDKARRVIMERIGLATAGEPYHDIRF Predict reactive species\nFull Name: BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)\nCalculated Molecular Weight: 81-91 kDa\nObserved Molecular Weight: 91 kDa\nGenBank Accession Number: BC001596\nGene Symbol: BAP1\nGene ID (NCBI): 8314\nRRID: AB_2180460\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92560\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868963066025,"sku":"10398-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10398-1-ap","provider":"Iright","version":"1.0","type":"link"}