{"product_id":"proteintech-10407-1-ap","title":"Proteintech, 10407-1-AP, Syntenin 2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Syntenin 2 (10407-1-AP) by Proteintech is a Polyclonal antibody targeting Syntenin 2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10407-1-AP targets Syntenin 2 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue, human liver tissue,  mouse brain tissue,  mouse heart tissue,  rat colon tissue\nPositive IHC detected in: human breast cancer tissue, human gliomas tissue,  rat colon tissue,  human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSyndecan-binding protein 2 (SDCBP2, Syntenin 2) is a protein containing two PDZ domains. PDZ domains facilitate protein-protein interactions by binding to the cytoplasmic C-terminus of transmembrane proteins. SDCBP2 binds with high affinity to PIP2 and is targeted to the plasma membrane, nucleoli and nuclear speckles via its PDZ domains (PMID: 15961997). SDCBP2 exists in two alternatively spliced variants, 2α and 2β, which differ in the lengths of their N-terminal regions. (PMID: 15276154)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0668 Product name: Recombinant human SDCBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-207 aa of BC002727 Sequence: MVAPVTGYSLGVRRAEIKPGVREIHLCKDERGKTGLRLRKVDQGLFVQLVQANTPASLVGLRFGDQLLQIDGRDCAGWSSHKAHQVVKKASGDKIVVVVRDRPFQRTVTMHKDSMGHVGFVIKKGKIVSLVKGSSAARNGLLTNHYVCEVDGQNVIGLKDKKIMEILATAGNVVTLTIIPSVIYEHMVKKLPPVLLHHTMDHSIPDA Predict reactive species\nFull Name: syndecan binding protein (syntenin) 2\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 35-37 kDa\nGenBank Accession Number: BC002727\nGene Symbol: Syntenin 2\nGene ID (NCBI): 27111\nRRID: AB_2183161\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H190\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869386854569,"sku":"10407-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10407-1-ap","provider":"Iright","version":"1.0","type":"link"}