{"product_id":"proteintech-10413-1-ap","title":"Proteintech, 10413-1-AP, PLUNC Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLUNC (10413-1-AP) by Proteintech is a Polyclonal antibody targeting PLUNC in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n10413-1-AP targets PLUNC in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue\nPositive IP detected in: mouse lung tissue\nPositive IHC detected in: mouse lung tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLUNC, also named as LUNX, NASG and SPURT, belongs to the BPI\/LBP\/Plunc superfamily and Plunc family. PLUNC may be involved in the airway inflammatory response after exposure to irritants. It is associated with tumor progression. PLUNC plays a role in innate immune responses of the upper airways.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0629 Product name: Recombinant human PLUNC protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-256 aa of BC012549 Sequence: MFQTGGLIVFYGLLAQTMAQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV Predict reactive species\nFull Name: palate, lung and nasal epithelium associated\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC012549\nGene Symbol: PLUNC\nGene ID (NCBI): 51297\nRRID: AB_2166093\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NP55\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869007401129,"sku":"10413-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10413-1-ap","provider":"Iright","version":"1.0","type":"link"}