{"product_id":"proteintech-10421-1-ap","title":"Proteintech, 10421-1-AP, CEA\/CD66e Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CEA\/CD66e (10421-1-AP) by Proteintech is a Polyclonal antibody targeting CEA\/CD66e in WB, IHC, IF-P, ELISA applications with reactivity to human samples\n10421-1-AP targets CEA\/CD66e in WB, IHC, IF-P, chIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-29 cells, MCF-7 cells,  human saliva\nPositive IHC detected in: human colon cancer tissue, human appendicitis tissue,  human stomach cancer tissue,  human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human colon cancer tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCarcinoembryonic antigen (CEA), also known as CEACAM5 or CD66e, is a cell surface glycoprotein belonging to the immunoglobulin superfamily, mainly serving as a cell adhesion molecule mediating intercellular contact by both homophilic and heterophilic binding (PMID: 21731662). CEA inhibits anoikis and plays a role in tumorigenesis and metastasis. CEA has been found to be overexpressed in a wide variety of human cancers, including colon, breast, and lung (PMID: 17167768). CEA is a tumor marker and is routinely exploited for diagnosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0672 Product name: Recombinant human CEACAM5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC034671 Sequence: MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDSASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQ Predict reactive species\nFull Name: carcinoembryonic antigen-related cell adhesion molecule 5\nCalculated Molecular Weight: 77 kDa\nObserved Molecular Weight: 180-200 kDa, 77 kDa\nGenBank Accession Number: BC034671\nGene Symbol: CEA\nGene ID (NCBI): 1048\nRRID: AB_2244691\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P06731\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868932591785,"sku":"10421-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10421-1-ap","provider":"Iright","version":"1.0","type":"link"}