{"product_id":"proteintech-10422-1-ap","title":"Proteintech, 10422-1-AP, SOX10 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SOX10 (10422-1-AP) by Proteintech is a Polyclonal antibody targeting SOX10 in WB, IHC, IF-Fro, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n10422-1-AP targets SOX10 in WB, IHC, IF-Fro, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, MDA-MB-453 cells,  mouse small intestine tissue,  SH-SY5Y cells\nPositive IP detected in: mouse colon tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-Fro detected in: mouse brain tissue\nPositive FC (Intra) detected in: C6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSox10 is a transcription factor that has a crucial role in complex signalling pathways regulating central nervous system and neural crest development. The calcualted molecular weight of SOX10 is 50 kDa, but modified SOX10 is about 55-60 kDa. (PMID: 23799842)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0673 Product name: Recombinant human SOX10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 267-466 aa of BC002824 Sequence: GKPHIDFGNVDIGEISHEVMSNMETFDVAELDQYLPPNGHPGHVSSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQVKTETAGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGHSGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP Predict reactive species\nFull Name: SRY (sex determining region Y)-box 10\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 50-60 kDa\nGenBank Accession Number: BC002824\nGene Symbol: SOX10\nGene ID (NCBI): 6663\nRRID: AB_2195371\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P56693\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868860895401,"sku":"10422-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10422-1-ap","provider":"Iright","version":"1.0","type":"link"}