{"product_id":"proteintech-10424-1-ap","title":"Proteintech, 10424-1-AP, JTV1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe JTV1 (10424-1-AP) by Proteintech is a Polyclonal antibody targeting JTV1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10424-1-AP targets JTV1 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HeLa cells,  K-562 cells,  NIH\/3T3 cells,  rat liver tissue,  L02 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: mouse cerebellum tissue, human kidney tissue,  mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nJTV1, also named p38, AIMP2, was first knew as a factor associated with macromolecular protein complex, which consists several different aminoacyl-tRNA synthetases. JTV1 is a scaffold protein required for the assembly and stability of the multi-tRNA synthetase complex. JTV1 could act as a mediator of TGF-beta signaling and its functional importance in the control of MYC during lung differentiation. Blocks MDM2-mediated ubiquitination and degradation of p53\/TP53. Functions as a proapoptotic factor. This is a rabbit polyclonal antibody raised against full-length of JTV1. There're two isoforms of JTV1 with MW about 27 kDa and 35 kDa,\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0675 Product name: Recombinant human JTV1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC002853 Sequence: MPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYGPAPGAGHVQEESNLSLQALESRQDDILKRLYELKAAVDGLSKMIQTPDADLDVTNIIQADEPTTLTTNALDLNSVLGKDYGALKDIVINANPASPPLSLLVLHRLLCEHFRVLSTVHTHSSVKSVPENLLKCFGEQNKKQPRQDYQLGFTLIWKNVPKTQMKFS Predict reactive species\nFull Name: JTV1 gene\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC002853\nGene Symbol: JTV1\nGene ID (NCBI): 7965\nRRID: AB_513880\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q13155\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868861747369,"sku":"10424-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10424-1-ap","provider":"Iright","version":"1.0","type":"link"}