{"product_id":"proteintech-10428-1-ap","title":"Proteintech, 10428-1-AP, MFI2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MFI2 (10428-1-AP) by Proteintech is a Polyclonal antibody targeting MFI2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n10428-1-AP targets MFI2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  HeLa cells,  Transfected\nPositive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMFI2 (Melanotransferrin\/Mtf\/TRMF), also known as p97 or CD228, is an iron-binding glycoprotein belonging to the transferrin family. Alternative RNA splicing yields two forms of different length transcripts, one (the longer) bound to the membrane (mMFI2) and the other (the shorter) secreted to the peripheral environment (sMFI2) such as blood and cell supernatant. MFI2 is upregulated in tumor tissues and has been identified as a serological marker of colorectal cancer (PMID: 25216327).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0700 Product name: Recombinant human MFI2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-302 aa of BC001875 Sequence: HVTIDTLKGVKSCHTGINRTVGWNVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPGAGETSYSESLCRLCRGDSSGEGVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDESPSRRQTWTRSEEEEGECPAHEEARRTMRSSAGQAWKWAPVHRPQDESDKGEFGKRAKSRDMLG Predict reactive species\nFull Name: antigen p97 (melanoma associated) identified by monoclonal antibodies 133.2 and 96.5\nCalculated Molecular Weight: 80 kDa\nObserved Molecular Weight: 82 kDa\nGenBank Accession Number: BC001875\nGene Symbol: MFI2\nGene ID (NCBI): 4241\nRRID: AB_2142592\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08582\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869471953065,"sku":"10428-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10428-1-ap","provider":"Iright","version":"1.0","type":"link"}