{"product_id":"proteintech-10436-1-ap","title":"Proteintech, 10436-1-AP, Caspase 2\/P32\/P18 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Caspase 2\/P32\/P18 (10436-1-AP) by Proteintech is a Polyclonal antibody targeting Caspase 2\/P32\/P18 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n10436-1-AP targets Caspase 2\/P32\/P18 in WB, IHC, IF, IP, RIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Staurosporine treated Jurkat cells, HeLa cells,  mouse liver tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCASP2(Caspase-2) is also named as ICH1, NEDD2 and belongs to the peptidase C14A family.It  is involved in the activation cascade of caspases responsible for apoptosis execution and might function by either activating some proteins required for cell death or inactivating proteins necessary for cell survival.It has 2 isoforms produced by alternative splicing and can exists almost as a dimer in solution(PMID:15865942).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rabbit\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0694 Product name: Recombinant human Caspase 2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-217 aa of BC002427 Sequence: MAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEMRELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSLPFPVCESCPLYKKLRLSTDTVEHSLDNKDGPLCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHFTGEKELE Predict reactive species\nFull Name: caspase 2, apoptosis-related cysteine peptidase\nCalculated Molecular Weight: 452 aa, 51 kDa\nObserved Molecular Weight: 48-51 kDa, 32 kDa, 18kDa\nGenBank Accession Number: BC002427\nGene Symbol: Caspase 2\nGene ID (NCBI): 835\nRRID: AB_2228450\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P42575\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868932198569,"sku":"10436-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10436-1-ap","provider":"Iright","version":"1.0","type":"link"}