{"product_id":"proteintech-10450-1-ap","title":"Proteintech, 10450-1-AP, Connexin 32 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Connexin 32 (10450-1-AP) by Proteintech is a Polyclonal antibody targeting Connexin 32 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples\n10450-1-AP targets Connexin 32 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue,  A375 cells,  human liver tissue,  mouse skin tissue\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: human liver cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nConnexin 32 (Cx32), also known as Gap junction beta 1 protein (GJB1),  belongs to the connexin family. Connexins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells. Connexin 32 is the major gap junction protein of liver, and the expression is also found in the brain and other organs. It is involved in tumorigenesis and liver regeneration. Connexin 32 plays an important role in peripheral nerve. Defects in Connexin 32 are the cause of Charcot-Marie-Tooth disease X-linked type 1 (CMTX1), an inherited peripheral neuropathy. Connexin 32 protein can be detected as a 27-32 kDa monomer and a 48-54 kDa dimer (PMID: 8266101; 8613761; 8608591; 19265674; 17972320; 19845480)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0659 Product name: Recombinant human Cx32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 134-283 aa of BC002805 Sequence: TYVISVVFRLLFEAVFMYVFYLLYPGYAMVRLVKCDVYPCPNTVDCFVSRPTEKTVFTVFMLAASGICIILNVAEVVYLIIRACARRAQRRSNPPSRKGSGFGHRLSPEYKQNEINKLLSEQDGSLKDILRRSPGTGAGLAEKSDRCSAC Predict reactive species\nFull Name: gap junction protein, beta 1, 32kDa\nCalculated Molecular Weight: 32 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC002805\nGene Symbol: Connexin-32\nGene ID (NCBI): 2705\nRRID: AB_2110629\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P08034\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868964114601,"sku":"10450-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10450-1-ap","provider":"Iright","version":"1.0","type":"link"}