{"product_id":"proteintech-10456-1-ap","title":"Proteintech, 10456-1-AP, NELF-A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NELF-A (10456-1-AP) by Proteintech is a Polyclonal antibody targeting NELF-A in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n10456-1-AP targets NELF-A in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse liver tissue,  Jurkat cells,  mouse brain tissue\nPositive IP detected in: mouse brain tissue\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:300-1:1200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nWHSC2, also known as NELF-A, is a component of the Negative ELongation Factor complex, which inhibits RNA polymerase II progression early during elongation (a process referred to as 'promoter proximal pausing'), thereby altering expression of its target genes in a positive and negative manner [PMID:19245807]. This complex acts with DRB sensitivity-inducing factor (DSIF), a heterodimer of SPT4 and SPT5, to cause transcriptional pausing of RNA polymerase II[PMID:12612062].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0708 Product name: Recombinant human NELF-A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-314 aa of BC002764 Sequence: ESDTGLWLHNKLGATDELWAPPSIASLLTAAVIDNIRLCFHGLSSAVKLKLLLGTLHLPRRTVDEMKGALMEIIQLASLDSDPWVLMVADILKSFPDTGSLNLELEEQNPNVQDILGELREKVGECEASAMLPLECQYLNKNALTTLAGPLTPPVKHFQLKRKPKSATLRAELLQKSTETAQQLKRSAGVPFHAKGRGLLRKMDTTTPLKGIPKQAPFRSPTAPSVFSPTGNRTPIPPSRTLLRKERGVKLLDISELDMVGAGREAKRRRKTLDAEVVEKPAKEETVVENATPDYAAGLVSTQKLGSLN Predict reactive species\nFull Name: Wolf-Hirschhorn syndrome candidate 2\nCalculated Molecular Weight: 57 kDa\nObserved Molecular Weight: 57 kDa\nGenBank Accession Number: BC002764\nGene Symbol: NELFA\nGene ID (NCBI): 7469\nRRID: AB_2216327\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9H3P2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869005631657,"sku":"10456-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10456-1-ap","provider":"Iright","version":"1.0","type":"link"}