{"product_id":"proteintech-10470-1-ap","title":"Proteintech, 10470-1-AP, CLINT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CLINT1 (10470-1-AP) by Proteintech is a Polyclonal antibody targeting CLINT1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10470-1-AP targets CLINT1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HEK-293 cells,  HeLa cells,  Jurkat cells,  mouse brain tissue\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nClathrin interactor 1 (CLINT1), also known as enthoprotin or epsin-4, belongs to the epsin family of endocytic adapter proteins. CLINT1 interacts with clathrin, the adapter protein AP-1 and phosphoinositides. It may have a role in the formation of clathrin coated vesicles and trafficking between the trans-Golgi network and endosomes. Mutations in the gene of CLINT1 are associated with a susceptibility to schizophrenia and psychotic disorders. Calculated molecular weight of CLINT1 is 68 kDa. The migration of endogenous CLINT1 at 80 kDa has also been reported (PMID: 12213833; 15811338).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0754 Product name: Recombinant human CLINT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 326-625 aa of BC004467 Sequence: LVDLFDGTSQSTGGSADLFGGFADFGSAAASGSFPSQVTATSGNGDFGDWSAFNQAPSGPVASSGEFFGSASQPAVELVSGSQSALGPPPAASNSSDLFDLMGSSQATMTSSQSMNFSMMSTNTVGLGLPMSRSQNTDMVQKSVSKTLPSTWSDPSVNISLDNLLPGMQPSKPQQPSLNTMIQQQNMQQPMNVMTQSFGAVNLSSPSNMLPVRPQTNALIGGPMPMSMPNVMTGTMGMAPLGNTPMMNQSMMGMNMNIGMSAAGMGLTGTMGMGMPNIAMTSGTVQPKQDAFANFANFSK Predict reactive species\nFull Name: clathrin interactor 1\nCalculated Molecular Weight: 68 kDa\nObserved Molecular Weight: 68 kDa, 80 kDa\nGenBank Accession Number: BC004467\nGene Symbol: CLINT1\nGene ID (NCBI): 9685\nRRID: AB_2276405\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14677\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869525561513,"sku":"10470-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10470-1-ap","provider":"Iright","version":"1.0","type":"link"}