{"product_id":"proteintech-10475-1-ap","title":"Proteintech, 10475-1-AP, TCL1A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TCL1A (10475-1-AP) by Proteintech is a Polyclonal antibody targeting TCL1A in WB, IHC, ELISA applications with reactivity to human samples\n10475-1-AP targets TCL1A in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells\nPositive IHC detected in: human tonsillitis tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTCL1A, also named TCL1 and p14 TCL1, enhances cell proliferation, stabilizes mitochondrial membrane potential and promotes cell survival. TCL1A immunodetection is an independent marker of adverse outcome that could be used in routine settings for the management of DLCL patients. TCL1A expression is correlated with shorter time to treatment in chronic lymphocytic leukemia cases and shorter lymphoma-specific survival in mantle cell lymphoma series. It is a potential therapeutic target.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0786 Product name: Recombinant human TCL1A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-114 aa of BC005831 Sequence: MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD Predict reactive species\nFull Name: T-cell leukemia\/lymphoma 1A\nCalculated Molecular Weight: 13 kDa\nObserved Molecular Weight: 14-16 kDa\nGenBank Accession Number: BC005831\nGene Symbol: TCL1A\nGene ID (NCBI): 8115\nRRID: AB_2255885\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P56279\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869776040105,"sku":"10475-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10475-1-ap","provider":"Iright","version":"1.0","type":"link"}