{"product_id":"proteintech-10486-1-ap","title":"Proteintech, 10486-1-AP, JUNB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe JUNB (10486-1-AP) by Proteintech is a Polyclonal antibody targeting JUNB in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples\n10486-1-AP targets JUNB in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HT-1080 cells, HeLa cells,  MCF-7 cells,  MDA-MB-231 cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human lymphoma tissue, human breast cancer tissue,  human ovary tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nJunB is one of the components of the Activator Protein-1 (AP-1) transcription complex that have been implicated in the control ofthe G0\/G1 transtion in fibroblasts. AP-1 is a collection of dimers formed by members of the Jun-, Fos-, ATF- and Maf multigene families that bind to specific DNA regulatory elements called AP-1\/12-O-tetradecanoylphorbol-13-acetate-responsive elements (TREs) and cAMP-responsive elements (CREs). JunB binds to the DNA sequence 5'-TGA[CG]TCA-3', and involves in the regulation of gene activity following the primary growth factor response. It also acts either as a tumor suppressor or as an oncogene depending on the cell and physiopathological context\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0752 Product name: Recombinant human JUNB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of BC004250 Sequence: MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGPEGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGGAGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPPVYTNLSSYSPASASSGGAGA Predict reactive species\nFull Name: jun B proto-oncogene\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 38 kDa, 42 kDa\nGenBank Accession Number: BC004250\nGene Symbol: JUNB\nGene ID (NCBI): 3726\nRRID: AB_2129996\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P17275\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868906639529,"sku":"10486-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10486-1-ap","provider":"Iright","version":"1.0","type":"link"}