{"product_id":"proteintech-10514-2-ap","title":"Proteintech, 10514-2-AP, Kallikrein 5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Kallikrein 5 (10514-2-AP) by Proteintech is a Polyclonal antibody targeting Kallikrein 5 in IHC, ELISA applications with reactivity to human, mouse samples\n10514-2-AP targets Kallikrein 5 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human skin tissue, mouse skin tissue,  mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKLK5(Kallikrein-5) is also named as SCTE and belongs to the kallikrein subfamily. This protein is predicted to be a secreted serine protease, and the enzyme is found to have proteolytic activity. In serum and ascites fluid, the protein is present in two forms, one at a relatively lower molecular mass (around 50 kDa), and another one around 150-180 kDa and native KLK5 is highly glycosylated or that it may interact with the gel filtration column, leading to delayed retention(PMID:12873991). The activation of the enzyme has been shown to require cleavage of an arginine residue (Arg66-Ile67), suggesting that a trypsin-like serine protease may be involved in this process(PMID:15713679).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0799 Product name: Recombinant human KLK5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 72-280 aa of BC008036 Sequence: DCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCK Predict reactive species\nFull Name: kallikrein-related peptidase 5\nCalculated Molecular Weight: 32 kDa\nGenBank Accession Number: BC008036\nGene Symbol: KLK5\nGene ID (NCBI): 25818\nRRID: AB_2134374\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y337\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869468119209,"sku":"10514-2-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10514-2-ap","provider":"Iright","version":"1.0","type":"link"}