{"product_id":"proteintech-10515-1-ap","title":"Proteintech, 10515-1-AP, LASP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LASP1 (10515-1-AP) by Proteintech is a Polyclonal antibody targeting LASP1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n10515-1-AP targets LASP1 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, MDA-MB-453s cells,  mouse brain tissue,  PC-3 cells,  MCF-7 cells,  Jurkat cells,  SGC-7901 cells,  SKOV-3 cells\nPositive IP detected in: A549 cells\nPositive IHC detected in: human colon cancer tissue, human breast cancer tissue,  human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A549 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:800-1:3200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLASP1(LIM and SH3 protein 1), also known as MLN50, is a 261 amino acid protein that localizes to both the cytoplasm and the cytoskeleton(PMID: 7589475). LASP1 consists of an N-terminal LIM-domain with two zinc finger motifs, followed by two central actin-binding nebulin repeats, flanked by a linker region and a C-terminal SH3 domain (PMID: 17177073, 9848085). LASP-1 interacts with F-Actin and plays an important role in the regulation of Actin-associated cytoskeletal organization. Agonist-dependent changes in LASP1 phosphorylation may regulate Actin-related ion transport activities in epithelial cells (PMID: 15465019,12571245). Overexpression of LASP-1 is associated with breast cancer, and plays a role in tumor transformation and metastasis (PMID: 17956604).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag0800 Product name: Recombinant human LASP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 125-210 aa of BC012460 Sequence: EFEKSRMGPSGGEGMEPERRDSQDGSSYRRPLEQQQPHHIPTSAPVYQQPQQQPVAQSYGGYKEPAAPVSIQRSAPGGGGKRYRAA Predict reactive species\nFull Name: LIM and SH3 protein 1\nCalculated Molecular Weight: 30 kDa\nObserved Molecular Weight: 38-40 kDa\nGenBank Accession Number: BC012460\nGene Symbol: LASP1\nGene ID (NCBI): 3927\nENSEMBL Gene ID: ENSG00000002834\nRRID: AB_2280966\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q14847\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868856864937,"sku":"10515-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-10515-1-ap","provider":"Iright","version":"1.0","type":"link"}